HORDB

ID: hor005239
Uniprot ID: P33713
Protein name: Big gastrin
Gene name: GAST
Organism: Didelphis virginiana (North American opossum) (Didelphis marsupialis virginiana)
Family: Gastrin/cholecystokinin family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Didelphis (genus), Didelphinae (subfamily), Didelphidae (family), Didelphimorphia (order), Metatheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity
GO BP: GO:0007165 signal transduction
GO CC: GO:0005576 extracellular region

Sequence: QLGPQDLPYLTADLSKKQGPWLEEEEAYGWMDF
Length: 33
Propeptide: QLGPQDLPYLTADLSKKQGPWLEEEEAYGWMDF
Signal peptide: NA
Modification: T1 Pyrrolidone carboxylic acid;T18 Pyrrolidone carboxylic acid;T28 Sulfotyrosine;T33 Phenylalanine amide
Glycosylation: NA
Mutagenesis: NA

Function: Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine.
Mechanism: NA
Cross BBB: NO
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

AF-P33713-F1.pdb

hor005239_AF2.pdb

hor005239_ESM.pdb

Mass:	442725	Formula:	C177H256N40O55S
Absent amino acids:	CHINRV	Common amino acids:	L
pI:	3.73	Basic residues:	2
Polar residues:	7	Hydrophobic residues:	10
Hydrophobicity:	-83.03	Boman Index:	-4634
Half-Life:	0.8 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	65.15
Instability Index:	7036.97	Extinction Coefficient cystines:	13980
Absorbance 280nm:	436.88